SCOPe 2.07: Domain d1wh5a1: 1wh5 A:8-74

Lineage for d1wh5a1 (1wh5 A:8-74)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein ZF-HD homeobox protein At5g65410 [116772] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116773] (1 PDB entry)
   Uniprot Q9FKP8 182-248

8. Domain d1wh5a1: 1wh5 A:8-74 [114633]
   Other proteins in same PDB: d1wh5a2, d1wh5a3
   Structural genomics target

Details for d1wh5a1

PDB Entry: 1wh5

PDB Description: solution structure of homeobox domain of arabidopsisthaliana zinc finger homeobox family protein

PDB Compounds: (A:) ZF-HD homeobox family protein

SCOPe Domain Sequences for d1wh5a1:

Sequence; same for both SEQRES and ATOM records:

>d1wh5a1 a.4.1.1 (A:8-74) ZF-HD homeobox protein At5g65410 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssaeagggirkrhrtkftaeqkermlalaerigwriqrqddeviqrfcqetgvprqvlkv
wlhnnkh

Timeline for d1wh5a1:

• d1wh5a1 first appeared in SCOP 1.71, called d1wh5a_
  
• d1wh5a1 appears in SCOPe 2.06
  
• d1wh5a1 appears in the current release, SCOPe 2.08