Lineage for d1wh5a_ (1wh5 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 532782Family a.4.1.1: Homeodomain [46690] (28 proteins)
    Pfam 00046
  6. 532923Protein ZF-HD homeobox protein At5g65410 [116772] (1 species)
  7. 532924Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116773] (1 PDB entry)
  8. 532925Domain d1wh5a_: 1wh5 A: [114633]
    Structural genomics target

Details for d1wh5a_

PDB Entry: 1wh5 (more details)

PDB Description: Solution structure of homeobox domain of Arabidopsisthaliana zinc finger homeobox family protein

SCOP Domain Sequences for d1wh5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh5a_ a.4.1.1 (A:) ZF-HD homeobox protein At5g65410 {Thale cress (Arabidopsis thaliana)}
gssgssgssaeagggirkrhrtkftaeqkermlalaerigwriqrqddeviqrfcqetgv
prqvlkvwlhnnkhsgpssg

SCOP Domain Coordinates for d1wh5a_:

Click to download the PDB-style file with coordinates for d1wh5a_.
(The format of our PDB-style files is described here.)

Timeline for d1wh5a_: