Lineage for d1wh5a1 (1wh5 A:8-74)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691961Protein ZF-HD homeobox protein At5g65410 [116772] (1 species)
  7. 2691962Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116773] (1 PDB entry)
    Uniprot Q9FKP8 182-248
  8. 2691963Domain d1wh5a1: 1wh5 A:8-74 [114633]
    Other proteins in same PDB: d1wh5a2, d1wh5a3
    Structural genomics target

Details for d1wh5a1

PDB Entry: 1wh5 (more details)

PDB Description: solution structure of homeobox domain of arabidopsisthaliana zinc finger homeobox family protein
PDB Compounds: (A:) ZF-HD homeobox family protein

SCOPe Domain Sequences for d1wh5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh5a1 a.4.1.1 (A:8-74) ZF-HD homeobox protein At5g65410 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ssaeagggirkrhrtkftaeqkermlalaerigwriqrqddeviqrfcqetgvprqvlkv
wlhnnkh

SCOPe Domain Coordinates for d1wh5a1:

Click to download the PDB-style file with coordinates for d1wh5a1.
(The format of our PDB-style files is described here.)

Timeline for d1wh5a1: