Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein ZF-HD homeobox protein At5g65410 [116772] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [116773] (1 PDB entry) Uniprot Q9FKP8 182-248 |
Domain d1wh5a1: 1wh5 A:8-74 [114633] Other proteins in same PDB: d1wh5a2, d1wh5a3 Structural genomics target |
PDB Entry: 1wh5 (more details)
SCOPe Domain Sequences for d1wh5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wh5a1 a.4.1.1 (A:8-74) ZF-HD homeobox protein At5g65410 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ssaeagggirkrhrtkftaeqkermlalaerigwriqrqddeviqrfcqetgvprqvlkv wlhnnkh
Timeline for d1wh5a1: