SCOP 1.71: Domain d1wh4a_: 1wh4 A:

Lineage for d1wh4a_ (1wh4 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (4 families)

5. Family a.77.1.2: DEATH domain, DD [81312] (8 proteins)
   Pfam 00531

6. Protein Interleukin-1 receptor-associated kinase 4, IRAK4 [116951] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [116952] (1 PDB entry)

8. Domain d1wh4a_: 1wh4 A: [114632]
   Structural genomics target

Details for d1wh4a_

PDB Entry: 1wh4

PDB Description: solution structure of the death domain of interleukin-1 receptor- associated kinase4 (irak4) from mus musculus

SCOP Domain Sequences for d1wh4a_:

Sequence; same for both SEQRES and ATOM records:

>d1wh4a_ a.77.1.2 (A:) Interleukin-1 receptor-associated kinase 4, IRAK4 {Mouse (Mus musculus)}
gssgssgmnkpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhi
rrfeallqtgksptcellfdwgttnctvgdlvdllvqielfapatlllpdavpqtvkslp
psgpssg

Timeline for d1wh4a_:

• d1wh4a_ is new in SCOP 1.71
  
• d1wh4a_ appears in SCOP 1.73
  
• d1wh4a_ appears in the current release, SCOPe 2.08, called d1wh4a1