Lineage for d1wh4a1 (1wh4 A:8-121)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327294Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2327295Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2327296Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2327315Protein Interleukin-1 receptor-associated kinase 4, IRAK4 [116951] (1 species)
  7. 2327316Species Mouse (Mus musculus) [TaxId:10090] [116952] (1 PDB entry)
    Uniprot Q8R4K2 1-114
  8. 2327317Domain d1wh4a1: 1wh4 A:8-121 [114632]
    Other proteins in same PDB: d1wh4a2, d1wh4a3
    Structural genomics target

Details for d1wh4a1

PDB Entry: 1wh4 (more details)

PDB Description: Solution structure of the DEATH domain of Interleukin-1 receptor-associated kinase4 (IRAK4) from Mus musculus
PDB Compounds: (A:) interleukin-1 receptor-associated kinase 4

SCOPe Domain Sequences for d1wh4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wh4a1 a.77.1.2 (A:8-121) Interleukin-1 receptor-associated kinase 4, IRAK4 {Mouse (Mus musculus) [TaxId: 10090]}
mnkpltpstyirnlnvgilrklsdfidpqegwkklavaikkpsgddrynqfhirrfeall
qtgksptcellfdwgttnctvgdlvdllvqielfapatlllpdavpqtvkslpp

SCOPe Domain Coordinates for d1wh4a1:

Click to download the PDB-style file with coordinates for d1wh4a1.
(The format of our PDB-style files is described here.)

Timeline for d1wh4a1: