Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (26 proteins) Pfam 00240 |
Protein 2'-5'-oligoadenylate synthetase-like protein, OASL [117808] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117809] (1 PDB entry) |
Domain d1wh3a_: 1wh3 A: [114631] Structural genomics target |
PDB Entry: 1wh3 (more details)
SCOP Domain Sequences for d1wh3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens)} gssgssgiqvfvknpdggsyayainpnsfilglkqqiedqqglpkkqqqlefqgqvlqdw lglgiygiqdsdtlilskkkgsgpssg
Timeline for d1wh3a_: