![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein 2'-5'-oligoadenylate synthetase-like protein, OASL [117808] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117809] (1 PDB entry) Uniprot Q15646 434-507 |
![]() | Domain d1wh3a1: 1wh3 A:8-81 [114631] Other proteins in same PDB: d1wh3a2, d1wh3a3 Structural genomics target |
PDB Entry: 1wh3 (more details)
SCOPe Domain Sequences for d1wh3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wh3a1 d.15.1.1 (A:8-81) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} iqvfvknpdggsyayainpnsfilglkqqiedqqglpkkqqqlefqgqvlqdwlglgiyg iqdsdtlilskkkg
Timeline for d1wh3a1: