SCOPe 2.06: Domain d1wh2a1: 1wh2 A:8-72

Lineage for d1wh2a1 (1wh2 A:8-72)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.76.1: GYF domain [55277] (1 family)

5. Family d.76.1.1: GYF domain [55278] (3 proteins)
   Pfam PF02213

6. Protein Hypothetical rotein At5g08430 [118022] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118023] (1 PDB entry)
   Uniprot Q9FT92 444-508; structure of the N-terminal SWIB domain (25-112) is also known (101202)

8. Domain d1wh2a1: 1wh2 A:8-72 [114630]
   Other proteins in same PDB: d1wh2a2, d1wh2a3
   Structural genomics target

Details for d1wh2a1

PDB Entry: 1wh2

PDB Description: solution structure of the gyf domain of a hypothetical protein from arabidopsis thaliana

PDB Compounds: (A:) Hypothetical protein At5g08430

SCOPe Domain Sequences for d1wh2a1:

Sequence; same for both SEQRES and ATOM records:

>d1wh2a1 d.76.1.1 (A:8-72) Hypothetical rotein At5g08430 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vrvlsydkeklnwlykdpqglvqgpfsltqlkawsdaeyftkqfrvwmtgesmesavllt
dvlrl

Timeline for d1wh2a1:

• d1wh2a1 first appeared in SCOP 1.71, called d1wh2a_
  
• d1wh2a1 was called d1wh2a_ in SCOPe 2.05
  
• d1wh2a1 appears in SCOPe 2.07
  
• d1wh2a1 appears in the current release, SCOPe 2.08