Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.76: GYF/BRK domain-like [55276] (2 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.76.1: GYF domain [55277] (1 family) |
Family d.76.1.1: GYF domain [55278] (3 proteins) Pfam PF02213 |
Protein Hypothetical rotein At5g08430 [118022] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118023] (1 PDB entry) Uniprot Q9FT92 444-508; structure of the N-terminal SWIB domain (25-112) is also known (101202) |
Domain d1wh2a1: 1wh2 A:8-72 [114630] Other proteins in same PDB: d1wh2a2, d1wh2a3 Structural genomics target |
PDB Entry: 1wh2 (more details)
SCOPe Domain Sequences for d1wh2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wh2a1 d.76.1.1 (A:8-72) Hypothetical rotein At5g08430 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} vrvlsydkeklnwlykdpqglvqgpfsltqlkawsdaeyftkqfrvwmtgesmesavllt dvlrl
Timeline for d1wh2a1: