SCOPe 2.08: Domain d1wgya1: 1wgy A:8-98

Lineage for d1wgya1 (1wgy A:8-98)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein Rap guanine nucleotide exchange factor 5, RapGEF5 [117825] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117826] (1 PDB entry)
   Uniprot Q92565 241-331

8. Domain d1wgya1: 1wgy A:8-98 [114627]
   Other proteins in same PDB: d1wgya2, d1wgya3
   Structural genomics target

Details for d1wgya1

PDB Entry: 1wgy

PDB Description: ra domain of guanine nucleotide exchange factor for rap1

PDB Compounds: (A:) Rap guanine nucleotide exchange factor 5

SCOPe Domain Sequences for d1wgya1:

Sequence; same for both SEQRES and ATOM records:

>d1wgya1 d.15.1.5 (A:8-98) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]}
eeifchvyitehsyvsvkakvssiaqeilkvvaekiqyaeedlalvaitfsgekhelqpn
dlvisksleasgriyvyrkdladtlnpfaen

Timeline for d1wgya1:

• d1wgya1 first appeared in SCOP 1.71, called d1wgya_
  
• d1wgya1 appears in SCOPe 2.07