![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
![]() | Protein Rap guanine nucleotide exchange factor 5, RapGEF5 [117825] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117826] (1 PDB entry) Uniprot Q92565 241-331 |
![]() | Domain d1wgya1: 1wgy A:8-98 [114627] Other proteins in same PDB: d1wgya2, d1wgya3 Structural genomics target |
PDB Entry: 1wgy (more details)
SCOPe Domain Sequences for d1wgya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgya1 d.15.1.5 (A:8-98) Rap guanine nucleotide exchange factor 5, RapGEF5 {Human (Homo sapiens) [TaxId: 9606]} eeifchvyitehsyvsvkakvssiaqeilkvvaekiqyaeedlalvaitfsgekhelqpn dlvisksleasgriyvyrkdladtlnpfaen
Timeline for d1wgya1: