Lineage for d1wgxa_ (1wgx A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 532956Family a.4.1.3: Myb/SANT domain [46739] (7 proteins)
  6. 532989Protein Hypothetical protein C14orf106 (KIAA1903) [116782] (1 species)
  7. 532990Species Human (Homo sapiens) [TaxId:9606] [116783] (1 PDB entry)
  8. 532991Domain d1wgxa_: 1wgx A: [114626]
    Structural genomics target

Details for d1wgxa_

PDB Entry: 1wgx (more details)

PDB Description: solution structure of rsgi ruh-022, a myb dna-binding domain in human cdna

SCOP Domain Sequences for d1wgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens)}
gssgssgdkewnekelqklhcafaslpkhkpgfwsevaaavgsrspeecqrkymenprgk
gsqkhvtsgpssg

SCOP Domain Coordinates for d1wgxa_:

Click to download the PDB-style file with coordinates for d1wgxa_.
(The format of our PDB-style files is described here.)

Timeline for d1wgxa_: