Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.3: Myb/SANT domain [46739] (16 proteins) |
Protein Hypothetical protein C14orf106 (KIAA1903) [116782] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [116783] (1 PDB entry) Uniprot Q6P0N0 877-936 |
Domain d1wgxa1: 1wgx A:8-67 [114626] Other proteins in same PDB: d1wgxa2, d1wgxa3 Structural genomics target |
PDB Entry: 1wgx (more details)
SCOPe Domain Sequences for d1wgxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgxa1 a.4.1.3 (A:8-67) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} dkewnekelqklhcafaslpkhkpgfwsevaaavgsrspeecqrkymenprgkgsqkhvt
Timeline for d1wgxa1: