Lineage for d1wgva_ (1wgv A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776751Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776752Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1776839Family b.15.1.4: Nuclear movement domain [117092] (2 proteins)
    Pfam PF03593
  6. 1776844Protein NudC domain containing protein 3, NUDCD3 (KIAA1068) [117095] (1 species)
  7. 1776845Species Human (Homo sapiens) [TaxId:9606] [117096] (1 PDB entry)
    Uniprot Q8IVD9 176-286
  8. 1776846Domain d1wgva_: 1wgv A: [114624]
    Structural genomics target

Details for d1wgva_

PDB Entry: 1wgv (more details)

PDB Description: Solution Structure of the CS Domain of Human KIAA1068 Protein
PDB Compounds: (A:) KIAA1068 protein

SCOPe Domain Sequences for d1wgva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]}
gssgssgqknpdsyngavrenytwsqdytdlevrvpvpkhvvkgkqvsvalssssirvam
leengervlmegklthkintesslwslepgkcvlvnlskvgeywwnailegeepididsg
pssg

SCOPe Domain Coordinates for d1wgva_:

Click to download the PDB-style file with coordinates for d1wgva_.
(The format of our PDB-style files is described here.)

Timeline for d1wgva_: