Lineage for d1wgva1 (1wgv A:8-118)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038915Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038916Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2039003Family b.15.1.4: Nuclear movement domain [117092] (2 protein domains)
    Pfam PF03593
  6. 2039008Protein NudC domain containing protein 3, NUDCD3 (KIAA1068) [117095] (1 species)
  7. 2039009Species Human (Homo sapiens) [TaxId:9606] [117096] (1 PDB entry)
    Uniprot Q8IVD9 176-286
  8. 2039010Domain d1wgva1: 1wgv A:8-118 [114624]
    Other proteins in same PDB: d1wgva2, d1wgva3
    Structural genomics target

Details for d1wgva1

PDB Entry: 1wgv (more details)

PDB Description: Solution Structure of the CS Domain of Human KIAA1068 Protein
PDB Compounds: (A:) KIAA1068 protein

SCOPe Domain Sequences for d1wgva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgva1 b.15.1.4 (A:8-118) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]}
qknpdsyngavrenytwsqdytdlevrvpvpkhvvkgkqvsvalssssirvamleenger
vlmegklthkintesslwslepgkcvlvnlskvgeywwnailegeepidid

SCOPe Domain Coordinates for d1wgva1:

Click to download the PDB-style file with coordinates for d1wgva1.
(The format of our PDB-style files is described here.)

Timeline for d1wgva1: