SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1wgva1 (1wgv A:8-118)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038915Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038916Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2039003Family b.15.1.4: Nuclear movement domain [117092] (2 protein domains)
    Pfam PF03593
  6. 2039008Protein NudC domain containing protein 3, NUDCD3 (KIAA1068) [117095] (1 species)
  7. 2039009Species Human (Homo sapiens) [TaxId:9606] [117096] (1 PDB entry)
    Uniprot Q8IVD9 176-286
  8. 2039010Domain d1wgva1: 1wgv A:8-118 [114624]
    Other proteins in same PDB: d1wgva2, d1wgva3
    Structural genomics target

Details for d1wgva1

PDB Entry: 1wgv (more details)

PDB Description: Solution Structure of the CS Domain of Human KIAA1068 Protein
PDB Compounds: (A:) KIAA1068 protein

SCOPe Domain Sequences for d1wgva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgva1 b.15.1.4 (A:8-118) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]}
qknpdsyngavrenytwsqdytdlevrvpvpkhvvkgkqvsvalssssirvamleenger
vlmegklthkintesslwslepgkcvlvnlskvgeywwnailegeepidid

SCOPe Domain Coordinates for d1wgva1:

Click to download the PDB-style file with coordinates for d1wgva1.
(The format of our PDB-style files is described here.)

Timeline for d1wgva1: