Lineage for d1wgua1 (1wgu A:8-130)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412882Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2412883Protein Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 [117259] (1 species)
  7. 2412884Species Mouse (Mus musculus) [TaxId:10090] [117260] (2 PDB entries)
    Uniprot Q9DBR4 582-704
  8. 2412885Domain d1wgua1: 1wgu A:8-130 [114623]
    Other proteins in same PDB: d1wgua2, d1wgua3
    Structural genomics target

Details for d1wgua1

PDB Entry: 1wgu (more details)

PDB Description: solution structure of the c-terminal phosphotyrosine interaction domain of apbb2 from mouse
PDB Compounds: (A:) amyloid beta (A4) precursor protein-bindin, family B, member 2

SCOPe Domain Sequences for d1wgua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgua1 b.55.1.2 (A:8-130) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]}
ptpktelvqkfrvqylgmlpvdrpvgmdtlnsaienlmtssskedwpsvnmnvadatvtv
isekneeevlvecrvrflsfmgvgkdvhtfafimdtgnqrfechvfwcepnaanvseavq
aac

SCOPe Domain Coordinates for d1wgua1:

Click to download the PDB-style file with coordinates for d1wgua1.
(The format of our PDB-style files is described here.)

Timeline for d1wgua1: