![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.3: Chromo barrel domain [117157] (4 proteins) typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain |
![]() | Protein Probable histone acetyltransferase MYST1 [117158] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117159] (1 PDB entry) Uniprot Q9D1P2 49-169 |
![]() | Domain d1wgsa1: 1wgs A:8-127 [114622] Other proteins in same PDB: d1wgsa2, d1wgsa3 Structural genomics target |
PDB Entry: 1wgs (more details)
SCOPe Domain Sequences for d1wgsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgsa1 b.34.13.3 (A:8-127) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} epevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrldewvdknrl altktvkdavqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpttaaleke
Timeline for d1wgsa1: