Lineage for d1wgsa_ (1wgs A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311416Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1311549Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
    typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain
  6. 1311554Protein Probable histone acetyltransferase MYST1 [117158] (1 species)
  7. 1311555Species Mouse (Mus musculus) [TaxId:10090] [117159] (1 PDB entry)
    Uniprot Q9D1P2 49-169
  8. 1311556Domain d1wgsa_: 1wgs A: [114622]
    Structural genomics target

Details for d1wgsa_

PDB Entry: 1wgs (more details)

PDB Description: Solution Structure of the Tudor Domain from Mouse Hypothetical Protein Homologous to Histone Acetyltransferase
PDB Compounds: (A:) MYST histone acetyltransferase 1

SCOPe Domain Sequences for d1wgsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgepevtveigetylcrrpdstwhsaeviqsrvndqegreefyvhyvgfnrrlde
wvdknrlaltktvkdavqknsekylselaeqperkitrnqkrkhdeinhvqktyaemdpt
taalekesgpssg

SCOPe Domain Coordinates for d1wgsa_:

Click to download the PDB-style file with coordinates for d1wgsa_.
(The format of our PDB-style files is described here.)

Timeline for d1wgsa_: