Lineage for d1wgra1 (1wgr A:8-94)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178530Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 2178547Protein Growth factor receptor-bound protein 7, GRB-7 [117823] (1 species)
  7. 2178548Species Human (Homo sapiens) [TaxId:9606] [117824] (1 PDB entry)
    Uniprot Q14451 100-186
  8. 2178549Domain d1wgra1: 1wgr A:8-94 [114621]
    Other proteins in same PDB: d1wgra2, d1wgra3
    Structural genomics target

Details for d1wgra1

PDB Entry: 1wgr (more details)

PDB Description: solution structure of the ra domain of human grb7 protein
PDB Compounds: (A:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d1wgra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgra1 d.15.1.5 (A:8-94) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]}
rphvvkvysedgacrsvevaagatarhvcemlvqrahalsdetwglvechphlalergle
dhesvvevqaawpvggdsrfvfrknfa

SCOPe Domain Coordinates for d1wgra1:

Click to download the PDB-style file with coordinates for d1wgra1.
(The format of our PDB-style files is described here.)

Timeline for d1wgra1: