Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
Protein Growth factor receptor-bound protein 7, GRB-7 [117823] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117824] (1 PDB entry) Uniprot Q14451 100-186 |
Domain d1wgra_: 1wgr A: [114621] Structural genomics target |
PDB Entry: 1wgr (more details)
SCOPe Domain Sequences for d1wgra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} gssgssgrphvvkvysedgacrsvevaagatarhvcemlvqrahalsdetwglvechphl alergledhesvvevqaawpvggdsrfvfrknfasgpssg
Timeline for d1wgra_: