Lineage for d1wgra_ (1wgr A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893599Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
    contains Pfam PF00788 and Pfam PF02196
  6. 1893616Protein Growth factor receptor-bound protein 7, GRB-7 [117823] (1 species)
  7. 1893617Species Human (Homo sapiens) [TaxId:9606] [117824] (1 PDB entry)
    Uniprot Q14451 100-186
  8. 1893618Domain d1wgra_: 1wgr A: [114621]
    Structural genomics target

Details for d1wgra_

PDB Entry: 1wgr (more details)

PDB Description: solution structure of the ra domain of human grb7 protein
PDB Compounds: (A:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d1wgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgrphvvkvysedgacrsvevaagatarhvcemlvqrahalsdetwglvechphl
alergledhesvvevqaawpvggdsrfvfrknfasgpssg

SCOPe Domain Coordinates for d1wgra_:

Click to download the PDB-style file with coordinates for d1wgra_.
(The format of our PDB-style files is described here.)

Timeline for d1wgra_: