SCOPe 2.04: Domain d1wgra_: 1wgr A:

Lineage for d1wgra_ (1wgr A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins)
   contains Pfam PF00788 and Pfam PF02196

6. Protein Growth factor receptor-bound protein 7, GRB-7 [117823] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117824] (1 PDB entry)
   Uniprot Q14451 100-186

8. Domain d1wgra_: 1wgr A: [114621]
   Structural genomics target

Details for d1wgra_

PDB Entry: 1wgr

PDB Description: solution structure of the ra domain of human grb7 protein

PDB Compounds: (A:) Growth factor receptor-bound protein 7

SCOPe Domain Sequences for d1wgra_:

Sequence; same for both SEQRES and ATOM records:

>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgrphvvkvysedgacrsvevaagatarhvcemlvqrahalsdetwglvechphl
alergledhesvvevqaawpvggdsrfvfrknfasgpssg

Timeline for d1wgra_:

• d1wgra_ first appeared in SCOP 1.71
  
• d1wgra_ appears in SCOPe 2.03
  
• d1wgra_ appears in SCOPe 2.05
  
• d1wgra_ appears in the current release, SCOPe 2.08, called d1wgra1