Lineage for d1wgra_ (1wgr A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598489Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 598694Family d.15.1.5: Ras-binding domain, RBD [54263] (9 proteins)
    contains Pfam 00788 and Pfam 02196
  6. 598702Protein Growth factor receptor-bound protein 7, GRB-7 [117823] (1 species)
  7. 598703Species Human (Homo sapiens) [TaxId:9606] [117824] (1 PDB entry)
  8. 598704Domain d1wgra_: 1wgr A: [114621]
    Structural genomics target

Details for d1wgra_

PDB Entry: 1wgr (more details)

PDB Description: solution structure of the ra domain of human grb7 protein

SCOP Domain Sequences for d1wgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens)}
gssgssgrphvvkvysedgacrsvevaagatarhvcemlvqrahalsdetwglvechphl
alergledhesvvevqaawpvggdsrfvfrknfasgpssg

SCOP Domain Coordinates for d1wgra_:

Click to download the PDB-style file with coordinates for d1wgra_.
(The format of our PDB-style files is described here.)

Timeline for d1wgra_: