![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.5: Ras-binding domain, RBD [54263] (14 proteins) contains Pfam PF00788 and Pfam PF02196 |
![]() | Protein Growth factor receptor-bound protein 7, GRB-7 [117823] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117824] (1 PDB entry) Uniprot Q14451 100-186 |
![]() | Domain d1wgra1: 1wgr A:8-94 [114621] Other proteins in same PDB: d1wgra2, d1wgra3 Structural genomics target |
PDB Entry: 1wgr (more details)
SCOPe Domain Sequences for d1wgra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgra1 d.15.1.5 (A:8-94) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} rphvvkvysedgacrsvevaagatarhvcemlvqrahalsdetwglvechphlalergle dhesvvevqaawpvggdsrfvfrknfa
Timeline for d1wgra1: