![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (12 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins) Pfam PF00169 |
![]() | Protein FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) [117250] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117251] (1 PDB entry) |
![]() | Domain d1wgqa_: 1wgq A: [114620] Structural genomics target |
PDB Entry: 1wgq (more details)
SCOP Domain Sequences for d1wgqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} gssgssgstmsgylyrskgskkpwkhlwfviknkvlytyaasedvaalesqpllgftvtl vkdenseskvfqllhkgmvfyvfkaddahstqrwidafqegtvsgpssg
Timeline for d1wgqa_: