SCOP 1.73: Domain d1wgqa_: 1wgq A:

Lineage for d1wgqa_ (1wgq A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (12 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
   Pfam PF00169

6. Protein FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) [117250] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117251] (1 PDB entry)

8. Domain d1wgqa_: 1wgq A: [114620]
   Structural genomics target

Details for d1wgqa_

PDB Entry: 1wgq

PDB Description: solution structure of the pleckstrin homology domain of mouse ethanol decreased 4 protein

PDB Compounds: (A:) FYVE, RhoGEF and PH domain containing 6; ethanol decreased 4

SCOP Domain Sequences for d1wgqa_:

Sequence; same for both SEQRES and ATOM records:

>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgstmsgylyrskgskkpwkhlwfviknkvlytyaasedvaalesqpllgftvtl
vkdenseskvfqllhkgmvfyvfkaddahstqrwidafqegtvsgpssg

Timeline for d1wgqa_:

• d1wgqa_ first appeared in SCOP 1.71
  
• d1wgqa_ appears in SCOP 1.75
  
• d1wgqa_ appears in the current release, SCOPe 2.08, called d1wgqa1