Lineage for d1wgqa_ (1wgq A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 563841Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 563842Superfamily b.55.1: PH domain-like [50729] (9 families) (S)
  5. 563843Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
    Pfam 00169
  6. 563898Protein FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) [117250] (1 species)
  7. 563899Species Mouse (Mus musculus) [TaxId:10090] [117251] (1 PDB entry)
  8. 563900Domain d1wgqa_: 1wgq A: [114620]
    Structural genomics target

Details for d1wgqa_

PDB Entry: 1wgq (more details)

PDB Description: solution structure of the pleckstrin homology domain of mouse ethanol decreased 4 protein

SCOP Domain Sequences for d1wgqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus)}
gssgssgstmsgylyrskgskkpwkhlwfviknkvlytyaasedvaalesqpllgftvtl
vkdenseskvfqllhkgmvfyvfkaddahstqrwidafqegtvsgpssg

SCOP Domain Coordinates for d1wgqa_:

Click to download the PDB-style file with coordinates for d1wgqa_.
(The format of our PDB-style files is described here.)

Timeline for d1wgqa_: