SCOPe 2.08: Domain d1wgqa1: 1wgq A:8-103

Lineage for d1wgqa1 (1wgq A:8-103)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) [117250] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117251] (1 PDB entry)
   Uniprot Q69ZL1 1303-1389

8. Domain d1wgqa1: 1wgq A:8-103 [114620]
   Other proteins in same PDB: d1wgqa2, d1wgqa3
   Structural genomics target

Details for d1wgqa1

PDB Entry: 1wgq

PDB Description: solution structure of the pleckstrin homology domain of mouse ethanol decreased 4 protein

PDB Compounds: (A:) FYVE, RhoGEF and PH domain containing 6; ethanol decreased 4

SCOPe Domain Sequences for d1wgqa1:

Sequence; same for both SEQRES and ATOM records:

>d1wgqa1 b.55.1.1 (A:8-103) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]}
stmsgylyrskgskkpwkhlwfviknkvlytyaasedvaalesqpllgftvtlvkdense
skvfqllhkgmvfyvfkaddahstqrwidafqegtv

Timeline for d1wgqa1:

• d1wgqa1 first appeared in SCOP 1.71, called d1wgqa_
  
• d1wgqa1 appears in SCOPe 2.07