![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.3: PKD domain [49299] (1 family) ![]() |
![]() | Family b.1.3.1: PKD domain [49300] (3 proteins) Pfam PF00801 |
![]() | Protein VPS10 domain-containing receptor SorCS2 [117059] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117060] (1 PDB entry) Uniprot Q96PQ0 760-869 |
![]() | Domain d1wgoa1: 1wgo A:8-117 [114618] Other proteins in same PDB: d1wgoa2, d1wgoa3 Structural genomics target |
PDB Entry: 1wgo (more details)
SCOPe Domain Sequences for d1wgoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgoa1 b.1.3.1 (A:8-117) VPS10 domain-containing receptor SorCS2 {Human (Homo sapiens) [TaxId: 9606]} ceggvdmqqsqvqlqcpltpprglqvsiqgeavavrpgedvlfvvrqeqgdvlttkyqvd lgdgfkamyvnltltgepirhryespgiyrvsvraentaghdeavlfvqv
Timeline for d1wgoa1: