Lineage for d1wgoa1 (1wgo A:8-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762416Superfamily b.1.3: PKD domain [49299] (1 family) (S)
  5. 2762417Family b.1.3.1: PKD domain [49300] (3 proteins)
    Pfam PF00801
  6. 2762427Protein VPS10 domain-containing receptor SorCS2 [117059] (1 species)
  7. 2762428Species Human (Homo sapiens) [TaxId:9606] [117060] (1 PDB entry)
    Uniprot Q96PQ0 760-869
  8. 2762429Domain d1wgoa1: 1wgo A:8-117 [114618]
    Other proteins in same PDB: d1wgoa2, d1wgoa3
    Structural genomics target

Details for d1wgoa1

PDB Entry: 1wgo (more details)

PDB Description: solution structure of the pkd domain from human vps10 domain- containing receptor sorcs2
PDB Compounds: (A:) VPS10 domain-containing receptor SorCS2

SCOPe Domain Sequences for d1wgoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgoa1 b.1.3.1 (A:8-117) VPS10 domain-containing receptor SorCS2 {Human (Homo sapiens) [TaxId: 9606]}
ceggvdmqqsqvqlqcpltpprglqvsiqgeavavrpgedvlfvvrqeqgdvlttkyqvd
lgdgfkamyvnltltgepirhryespgiyrvsvraentaghdeavlfvqv

SCOPe Domain Coordinates for d1wgoa1:

Click to download the PDB-style file with coordinates for d1wgoa1.
(The format of our PDB-style files is described here.)

Timeline for d1wgoa1: