Lineage for d1wgna_ (1wgn A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763614Family a.5.2.1: UBA domain [46935] (24 proteins)
  6. 763713Protein Ubiquitin-associated protein 1, UBAP1 [116830] (1 species)
  7. 763714Species Human (Homo sapiens) [TaxId:9606] [116831] (1 PDB entry)
    Uniprot Q9NZ09 381-430
  8. 763715Domain d1wgna_: 1wgn A: [114617]
    Structural genomics target

Details for d1wgna_

PDB Entry: 1wgn (more details)

PDB Description: solution structure of uba domain of human ubiquitin associated protein 1 (ubap1)
PDB Compounds: (A:) ubiquitin associated protein

SCOP Domain Sequences for d1wgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]}
gssgssgayselqmlspserqcvetvvnmgysyecvlramkkkgenieqildylfahsgp
ssg

SCOP Domain Coordinates for d1wgna_:

Click to download the PDB-style file with coordinates for d1wgna_.
(The format of our PDB-style files is described here.)

Timeline for d1wgna_: