Lineage for d1wgma1 (1wgm A:8-92)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264130Family g.44.1.2: U-box [90222] (5 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 2264144Protein Ubiquitin conjugation factor E4A [118298] (1 species)
  7. 2264145Species Human (Homo sapiens) [TaxId:9606] [118299] (1 PDB entry)
    Uniprot Q14139 977-1061
  8. 2264146Domain d1wgma1: 1wgm A:8-92 [114616]
    Other proteins in same PDB: d1wgma2, d1wgma3
    Structural genomics target

Details for d1wgma1

PDB Entry: 1wgm (more details)

PDB Description: solution structure of the u-box in human ubiquitin conjugation factor e4a
PDB Compounds: (A:) Ubiquitin conjugation factor E4A

SCOPe Domain Sequences for d1wgma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgma1 g.44.1.2 (A:8-92) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}
lqqqeeetyadacdefldpimstlmcdpvvlpssrvtvdrstiarhllsdqtdpfnrspl
tmdqirpntelkekiqrwlaerkqq

SCOPe Domain Coordinates for d1wgma1:

Click to download the PDB-style file with coordinates for d1wgma1.
(The format of our PDB-style files is described here.)

Timeline for d1wgma1: