Lineage for d1wgma_ (1wgm A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625077Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 625078Superfamily g.44.1: RING/U-box [57850] (3 families) (S)
  5. 625125Family g.44.1.2: U-box [90222] (3 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 625132Protein Ubiquitin conjugation factor E4A [118298] (1 species)
  7. 625133Species Human (Homo sapiens) [TaxId:9606] [118299] (1 PDB entry)
  8. 625134Domain d1wgma_: 1wgm A: [114616]
    Structural genomics target

Details for d1wgma_

PDB Entry: 1wgm (more details)

PDB Description: solution structure of the u-box in human ubiquitin conjugation factor e4a

SCOP Domain Sequences for d1wgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens)}
gssgssglqqqeeetyadacdefldpimstlmcdpvvlpssrvtvdrstiarhllsdqtd
pfnrspltmdqirpntelkekiqrwlaerkqqsgpssg

SCOP Domain Coordinates for d1wgma_:

Click to download the PDB-style file with coordinates for d1wgma_.
(The format of our PDB-style files is described here.)

Timeline for d1wgma_: