![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
![]() | Superfamily g.44.1: RING/U-box [57850] (7 families) ![]() |
![]() | Family g.44.1.2: U-box [90222] (5 proteins) Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues |
![]() | Protein Ubiquitin conjugation factor E4A [118298] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118299] (1 PDB entry) Uniprot Q14139 977-1061 |
![]() | Domain d1wgma1: 1wgm A:8-92 [114616] Other proteins in same PDB: d1wgma2, d1wgma3 Structural genomics target |
PDB Entry: 1wgm (more details)
SCOPe Domain Sequences for d1wgma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgma1 g.44.1.2 (A:8-92) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} lqqqeeetyadacdefldpimstlmcdpvvlpssrvtvdrstiarhllsdqtdpfnrspl tmdqirpntelkekiqrwlaerkqq
Timeline for d1wgma1: