SCOPe 2.08: Domain d1wgma1: 1wgm A:8-92

Lineage for d1wgma1 (1wgm A:8-92)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.2: U-box [90222] (5 proteins)
   Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues

6. Protein Ubiquitin conjugation factor E4A [118298] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118299] (1 PDB entry)
   Uniprot Q14139 977-1061

8. Domain d1wgma1: 1wgm A:8-92 [114616]
   Other proteins in same PDB: d1wgma2, d1wgma3
   Structural genomics target

Details for d1wgma1

PDB Entry: 1wgm

PDB Description: solution structure of the u-box in human ubiquitin conjugation factor e4a

PDB Compounds: (A:) Ubiquitin conjugation factor E4A

SCOPe Domain Sequences for d1wgma1:

Sequence; same for both SEQRES and ATOM records:

>d1wgma1 g.44.1.2 (A:8-92) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}
lqqqeeetyadacdefldpimstlmcdpvvlpssrvtvdrstiarhllsdqtdpfnrspl
tmdqirpntelkekiqrwlaerkqq

Timeline for d1wgma1:

• d1wgma1 first appeared in SCOP 1.71, called d1wgma_
  
• d1wgma1 appears in SCOPe 2.07