Lineage for d1wgla1 (1wgl A:8-53)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985536Family a.5.2.4: CUE domain [88995] (4 proteins)
    Pfam PF02845
  6. 1985543Protein Toll-interacting protein [116837] (1 species)
  7. 1985544Species Human (Homo sapiens) [TaxId:9606] [116838] (1 PDB entry)
    Uniprot Q9H0E2 229-274
  8. 1985545Domain d1wgla1: 1wgl A:8-53 [114615]
    Other proteins in same PDB: d1wgla2, d1wgla3
    Structural genomics target

Details for d1wgla1

PDB Entry: 1wgl (more details)

PDB Description: solution structure of cue domain in the c-terminal of human toll- interacting protein (tollip)
PDB Compounds: (A:) Toll-interacting protein

SCOPe Domain Sequences for d1wgla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgla1 a.5.2.4 (A:8-53) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]}
cseedlkaiqdmfpnmdqevirsvleaqrgnkdaainsllqmgeep

SCOPe Domain Coordinates for d1wgla1:

Click to download the PDB-style file with coordinates for d1wgla1.
(The format of our PDB-style files is described here.)

Timeline for d1wgla1: