Lineage for d1wgka_ (1wgk A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598488Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 598798Superfamily d.15.3: MoaD/ThiS [54285] (3 families) (S)
    possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies
  5. 598830Family d.15.3.3: C9orf74 homolog [117833] (1 protein)
  6. 598831Protein C9orf74 homolog [117834] (1 species)
  7. 598832Species Mouse (Mus musculus) [TaxId:10090] [117835] (2 PDB entries)
  8. 598833Domain d1wgka_: 1wgk A: [114614]
    Structural genomics target

Details for d1wgka_

PDB Entry: 1wgk (more details)

PDB Description: Solution Structure of Mouse Hypothetical Protein 2900073H19RIK

SCOP Domain Sequences for d1wgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgka_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus)}
gssgssgmaaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllker
pelfiqgdsvrpgilvlindadwellgeldyqlqdqdsilfistlhggsgpssg

SCOP Domain Coordinates for d1wgka_:

Click to download the PDB-style file with coordinates for d1wgka_.
(The format of our PDB-style files is described here.)

Timeline for d1wgka_: