SCOPe 2.08: Domain d1wgka1: 1wgk A:8-108

Lineage for d1wgka1 (1wgk A:8-108)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.3: MoaD/ThiS [54285] (5 families)
   possible link between the ubiquitin-like and 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.3.3: C9orf74 homolog [117833] (1 protein)
   automatically mapped to Pfam PF09138

6. Protein C9orf74 homolog [117834] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117835] (2 PDB entries)
   Uniprot Q9D2P4 #

8. Domain d1wgka1: 1wgk A:8-108 [114614]
   Other proteins in same PDB: d1wgka2, d1wgka3
   Structural genomics target

Details for d1wgka1

PDB Entry: 1wgk

PDB Description: solution structure of mouse hypothetical protein 2900073h19rik

PDB Compounds: (A:) RIKEN cDNA 2900073H19 protein

SCOPe Domain Sequences for d1wgka1:

Sequence; same for both SEQRES and ATOM records:

>d1wgka1 d.15.3.3 (A:8-108) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]}
maaplcvkvefgggaellfdgvkkhqvalpgqeepwdirnllvwikknllkerpelfiqg
dsvrpgilvlindadwellgeldyqlqdqdsilfistlhgg

Timeline for d1wgka1:

• d1wgka1 first appeared in SCOP 1.71, called d1wgka_
  
• d1wgka1 appears in SCOPe 2.07