Lineage for d1wgha_ (1wgh A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1638032Protein Ubiquitin-like protein 3, Ubl3 [117806] (1 species)
  7. 1638033Species Mouse (Mus musculus) [TaxId:10090] [117807] (1 PDB entry)
    Uniprot Q9Z2M6 1-103
  8. 1638034Domain d1wgha_: 1wgh A: [114613]
    Structural genomics target

Details for d1wgha_

PDB Entry: 1wgh (more details)

PDB Description: solution structure of mouse ubiquitin-like 3 protein
PDB Compounds: (A:) ubiquitin-like 3

SCOPe Domain Sequences for d1wgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmsshvpadminlrlilvsgktkeflfspndsasdiakhvydnwpmdweeeqvs
spnilrliyqgrflhgnvtlgalklpfgkttvmhlvaretlpepnsqgqrsgpssg

SCOPe Domain Coordinates for d1wgha_:

Click to download the PDB-style file with coordinates for d1wgha_.
(The format of our PDB-style files is described here.)

Timeline for d1wgha_: