SCOPe 2.08: Domain d1wgha1: 1wgh A:8-110

Lineage for d1wgha1 (1wgh A:8-110)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin-like protein 3, Ubl3 [117806] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117807] (1 PDB entry)
   Uniprot Q9Z2M6 1-103

8. Domain d1wgha1: 1wgh A:8-110 [114613]
   Other proteins in same PDB: d1wgha2, d1wgha3
   Structural genomics target

Details for d1wgha1

PDB Entry: 1wgh

PDB Description: solution structure of mouse ubiquitin-like 3 protein

PDB Compounds: (A:) ubiquitin-like 3

SCOPe Domain Sequences for d1wgha1:

Sequence; same for both SEQRES and ATOM records:

>d1wgha1 d.15.1.1 (A:8-110) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]}
msshvpadminlrlilvsgktkeflfspndsasdiakhvydnwpmdweeeqvsspnilrl
iyqgrflhgnvtlgalklpfgkttvmhlvaretlpepnsqgqr

Timeline for d1wgha1:

• d1wgha1 first appeared in SCOP 1.71, called d1wgha_
  
• d1wgha1 appears in SCOPe 2.07