![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Ubiquitin-like protein 3, Ubl3 [117806] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117807] (1 PDB entry) Uniprot Q9Z2M6 1-103 |
![]() | Domain d1wgha1: 1wgh A:8-110 [114613] Other proteins in same PDB: d1wgha2, d1wgha3 Structural genomics target |
PDB Entry: 1wgh (more details)
SCOPe Domain Sequences for d1wgha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgha1 d.15.1.1 (A:8-110) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} msshvpadminlrlilvsgktkeflfspndsasdiakhvydnwpmdweeeqvsspnilrl iyqgrflhgnvtlgalklpfgkttvmhlvaretlpepnsqgqr
Timeline for d1wgha1: