SCOPe 2.04: Domain d1wgga_: 1wgg A:

Lineage for d1wgga_ (1wgg A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Ubiquitin carboxyl-terminal hydrolase 14 [117804] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117805] (1 PDB entry)
   Uniprot Q9JMA1 3-85

8. Domain d1wgga_: 1wgg A: [114612]
   Structural genomics target

Details for d1wgga_

PDB Entry: 1wgg

PDB Description: solution structure of the n-terminal ubiquitin-like domain of mouse ubiquitin specific protease 14 (usp14)

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 14

SCOPe Domain Sequences for d1wgga_:

Sequence; same for both SEQRES and ATOM records:

>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgysvtvkwgkekfegvelntdeppmvfkaqlfaltgvqparqkvmvkggtlkdd
dwgnikmkngmtvlmmgsadalpeepsaktsgpssg

Timeline for d1wgga_:

• d1wgga_ first appeared in SCOP 1.71
  
• d1wgga_ appears in SCOPe 2.03
  
• d1wgga_ appears in SCOPe 2.05
  
• d1wgga_ appears in the current release, SCOPe 2.08, called d1wgga1