Lineage for d1wgga_ (1wgg A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1195035Protein Ubiquitin carboxyl-terminal hydrolase 14 [117804] (1 species)
  7. 1195036Species Mouse (Mus musculus) [TaxId:10090] [117805] (1 PDB entry)
    Uniprot Q9JMA1 3-85
  8. 1195037Domain d1wgga_: 1wgg A: [114612]
    Structural genomics target

Details for d1wgga_

PDB Entry: 1wgg (more details)

PDB Description: Solution Structure of the N-terminal Ubiquitin-like Domain of Mouse Ubiquitin Specific Protease 14 (USP14)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 14

SCOPe Domain Sequences for d1wgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgysvtvkwgkekfegvelntdeppmvfkaqlfaltgvqparqkvmvkggtlkdd
dwgnikmkngmtvlmmgsadalpeepsaktsgpssg

SCOPe Domain Coordinates for d1wgga_:

Click to download the PDB-style file with coordinates for d1wgga_.
(The format of our PDB-style files is described here.)

Timeline for d1wgga_: