![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (6 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (26 proteins) Pfam 00240 |
![]() | Protein Ubiquitin carboxyl-terminal hydrolase 14 [117804] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117805] (1 PDB entry) |
![]() | Domain d1wgga_: 1wgg A: [114612] Structural genomics target |
PDB Entry: 1wgg (more details)
SCOP Domain Sequences for d1wgga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus)} gssgssgysvtvkwgkekfegvelntdeppmvfkaqlfaltgvqparqkvmvkggtlkdd dwgnikmkngmtvlmmgsadalpeepsaktsgpssg
Timeline for d1wgga_: