Lineage for d1wgga1 (1wgg A:8-90)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932356Protein Ubiquitin carboxyl-terminal hydrolase 14 [117804] (1 species)
  7. 2932357Species Mouse (Mus musculus) [TaxId:10090] [117805] (1 PDB entry)
    Uniprot Q9JMA1 3-85
  8. 2932358Domain d1wgga1: 1wgg A:8-90 [114612]
    Other proteins in same PDB: d1wgga2, d1wgga3
    Structural genomics target

Details for d1wgga1

PDB Entry: 1wgg (more details)

PDB Description: solution structure of the n-terminal ubiquitin-like domain of mouse ubiquitin specific protease 14 (usp14)
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 14

SCOPe Domain Sequences for d1wgga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgga1 d.15.1.1 (A:8-90) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]}
ysvtvkwgkekfegvelntdeppmvfkaqlfaltgvqparqkvmvkggtlkdddwgnikm
kngmtvlmmgsadalpeepsakt

SCOPe Domain Coordinates for d1wgga1:

Click to download the PDB-style file with coordinates for d1wgga1.
(The format of our PDB-style files is described here.)

Timeline for d1wgga1: