SCOPe 2.07: Domain d1wgfa1: 1wgf A:8-84

Lineage for d1wgfa1 (1wgf A:8-84)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
   Contains 6 HMG-box domains

7. Species Mouse (Mus musculus) [TaxId:10090] [109764] (3 PDB entries)
   Uniprot P25976 388-383, 392-470, 567-655

8. Domain d1wgfa1: 1wgf A:8-84 [114611]
   Other proteins in same PDB: d1wgfa2, d1wgfa3
   Structural genomics target; HMG-box 4

Details for d1wgfa1

PDB Entry: 1wgf

PDB Description: solution structure of the 4th hmg-box of mouse ubf1

PDB Compounds: (A:) Upstream binding factor 1

SCOPe Domain Sequences for d1wgfa1:

Sequence; same for both SEQRES and ATOM records:

>d1wgfa1 a.21.1.1 (A:8-84) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]}
kpsqeggkggsekpkrpvsamfifseekrrqlqeerpelseseltrllarmwndlsekkk
akykareaalkaqserk

Timeline for d1wgfa1:

• d1wgfa1 first appeared in SCOP 1.71, called d1wgfa_
  
• d1wgfa1 appears in SCOPe 2.06
  
• d1wgfa1 appears in the current release, SCOPe 2.08