SCOP 1.73: Domain d1wgfa_: 1wgf A:

Lineage for d1wgfa_ (1wgf A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (1 family)

5. Family a.21.1.1: HMG-box [47096] (9 proteins)

6. Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
   Contains 6 HMG-box domains

7. Species Mouse (Mus musculus) [TaxId:10090] [109764] (3 PDB entries)

8. Domain d1wgfa_: 1wgf A: [114611]
   Structural genomics target; HMG-box 4

Details for d1wgfa_

PDB Entry: 1wgf

PDB Description: solution structure of the 4th hmg-box of mouse ubf1

PDB Compounds: (A:) Upstream binding factor 1

SCOP Domain Sequences for d1wgfa_:

Sequence; same for both SEQRES and ATOM records:

>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkpsqeggkggsekpkrpvsamfifseekrrqlqeerpelseseltrllarmwn
dlsekkkakykareaalkaqserksgpssg

Timeline for d1wgfa_:

• d1wgfa_ first appeared in SCOP 1.71
  
• d1wgfa_ appears in SCOP 1.75
  
• d1wgfa_ appears in the current release, SCOPe 2.08, called d1wgfa1