Lineage for d1wgfa_ (1wgf A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 535057Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 535058Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 535059Family a.21.1.1: HMG-box [47096] (9 proteins)
  6. 535090Protein Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) [68982] (2 species)
    Contains 6 HMG-box domains
  7. 535095Species Mouse (Mus musculus) [TaxId:10090] [109764] (3 PDB entries)
  8. 535098Domain d1wgfa_: 1wgf A: [114611]
    Structural genomics target; HMG-box 4

Details for d1wgfa_

PDB Entry: 1wgf (more details)

PDB Description: Solution structure of the 4th HMG-box of mouse UBF1

SCOP Domain Sequences for d1wgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus)}
gssgssgkpsqeggkggsekpkrpvsamfifseekrrqlqeerpelseseltrllarmwn
dlsekkkakykareaalkaqserksgpssg

SCOP Domain Coordinates for d1wgfa_:

Click to download the PDB-style file with coordinates for d1wgfa_.
(The format of our PDB-style files is described here.)

Timeline for d1wgfa_: