Lineage for d1wgba_ (1wgb A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317892Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1317893Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1318022Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 1318050Protein Putative flavoprotein TTHA0420 [117234] (1 species)
  7. 1318051Species Thermus thermophilus [TaxId:274] [117235] (2 PDB entries)
    Uniprot Q5SL73
  8. 1318053Domain d1wgba_: 1wgb A: [114609]
    Structural genomics target

Details for d1wgba_

PDB Entry: 1wgb (more details), 2 Å

PDB Description: Crystal structure of a probable flavoprotein from Thermus thermophilus HB8
PDB Compounds: (A:) probable flavoprotein

SCOPe Domain Sequences for d1wgba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wgba_ b.45.1.2 (A:) Putative flavoprotein TTHA0420 {Thermus thermophilus [TaxId: 274]}
mnleakkkvlrsftyglyvltakdgdevaagtvnwvtqasfqpplvavglkrdshlhalv
ertgklalmtlahdqkaiaqdffkptvregdrlnghpfepsptfglplltelpywleaev
rhlypggdhslvvaevveagvrreekplvmwdtgwfygg

SCOPe Domain Coordinates for d1wgba_:

Click to download the PDB-style file with coordinates for d1wgba_.
(The format of our PDB-style files is described here.)

Timeline for d1wgba_: