Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (41 families) |
Family c.66.1.23: MraW-like putative methyltransferases [82475] (1 protein) |
Protein TM0872, methyltransferase domain [82476] (2 species) contains an inserted alpha helical subdomain |
Species Thermus thermophilus [TaxId:274] [117678] (1 PDB entry) |
Domain d1wg8b2: 1wg8 B:5-108,B:207-284 [114608] Other proteins in same PDB: d1wg8a1, d1wg8b1 Structural genomics target complexed with sam |
PDB Entry: 1wg8 (more details), 2 Å
SCOP Domain Sequences for d1wg8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg8b2 c.66.1.23 (B:5-108,B:207-284) TM0872, methyltransferase domain {Thermus thermophilus} thvpvlyqealdllavrpggvyvdatlggaghargilerggrvigldqdpeavarakglh lpgltvvqgnfrhlkrhlaalgvervdgiladlgvssfhlddpsXdelnalkefleqaae vlapggrlvviafhsledrvvkrflresglkvltkkplvpsekeaaqnprarsaklraae kea
Timeline for d1wg8b2: