SCOPe 2.05: Domain d1wg8b1: 1wg8 B:109-206

Lineage for d1wg8b1 (1wg8 B:109-206)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.13: Putative methyltransferase TM0872, insert domain [81799] (1 family)

5. Family a.60.13.1: Putative methyltransferase TM0872, insert domain [81800] (1 protein)

6. Protein Putative methyltransferase TM0872, insert domain [81801] (2 species)

7. Species Thermus thermophilus [TaxId:274] [116940] (1 PDB entry)
   Uniprot Q5SJD8

8. Domain d1wg8b1: 1wg8 B:109-206 [114607]
   Other proteins in same PDB: d1wg8a2, d1wg8b2
   Structural genomics target
   complexed with sam

Details for d1wg8b1

PDB Entry: 1wg8, 2 Å

PDB Description: Crystal structure of a predicted S-adenosylmethionine-dependent methyltransferase TT1512 from Thermus thermophilus HB8.

PDB Compounds: (B:) predicted S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wg8b1:

Sequence; same for both SEQRES and ATOM records:

>d1wg8b1 a.60.13.1 (B:109-206) Putative methyltransferase TM0872, insert domain {Thermus thermophilus [TaxId: 274]}
rgfsyqkegpldmrmglegptakevvnrlplealarllrelgeepqayriaraivaarek
apietttqlaeivrkavgfrraghparktfqalriyvn

Timeline for d1wg8b1:

• d1wg8b1 first appeared in SCOP 1.71
  
• d1wg8b1 appears in SCOPe 2.04
  
• d1wg8b1 appears in SCOPe 2.06
  
• d1wg8b1 appears in the current release, SCOPe 2.08