Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.13: Putative methyltransferase TM0872, insert domain [81799] (1 family) |
Family a.60.13.1: Putative methyltransferase TM0872, insert domain [81800] (1 protein) |
Protein Putative methyltransferase TM0872, insert domain [81801] (2 species) |
Species Thermus thermophilus [TaxId:274] [116940] (1 PDB entry) Uniprot Q5SJD8 |
Domain d1wg8b1: 1wg8 B:109-206 [114607] Other proteins in same PDB: d1wg8a2, d1wg8b2 Structural genomics target complexed with sam |
PDB Entry: 1wg8 (more details), 2 Å
SCOPe Domain Sequences for d1wg8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg8b1 a.60.13.1 (B:109-206) Putative methyltransferase TM0872, insert domain {Thermus thermophilus [TaxId: 274]} rgfsyqkegpldmrmglegptakevvnrlplealarllrelgeepqayriaraivaarek apietttqlaeivrkavgfrraghparktfqalriyvn
Timeline for d1wg8b1: