Lineage for d1wg8a2 (1wg8 A:5-108,A:207-284)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1865072Family c.66.1.23: MraW-like putative methyltransferases [82475] (1 protein)
  6. 1865073Protein TM0872, methyltransferase domain [82476] (2 species)
    contains an inserted alpha helical subdomain
  7. 1865079Species Thermus thermophilus [TaxId:274] [117678] (1 PDB entry)
    Uniprot Q5SJD8
  8. 1865080Domain d1wg8a2: 1wg8 A:5-108,A:207-284 [114606]
    Other proteins in same PDB: d1wg8a1, d1wg8b1
    Structural genomics target
    complexed with sam

Details for d1wg8a2

PDB Entry: 1wg8 (more details), 2 Å

PDB Description: Crystal structure of a predicted S-adenosylmethionine-dependent methyltransferase TT1512 from Thermus thermophilus HB8.
PDB Compounds: (A:) predicted S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wg8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]}
thvpvlyqealdllavrpggvyvdatlggaghargilerggrvigldqdpeavarakglh
lpgltvvqgnfrhlkrhlaalgvervdgiladlgvssfhlddpsXdelnalkefleqaae
vlapggrlvviafhsledrvvkrflresglkvltkkplvpsekeaaqnprarsaklraae
kea

SCOPe Domain Coordinates for d1wg8a2:

Click to download the PDB-style file with coordinates for d1wg8a2.
(The format of our PDB-style files is described here.)

Timeline for d1wg8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wg8a1