Lineage for d1wg8a1 (1wg8 A:109-206)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998615Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1999778Superfamily a.60.13: Putative methyltransferase TM0872, insert domain [81799] (1 family) (S)
  5. 1999779Family a.60.13.1: Putative methyltransferase TM0872, insert domain [81800] (1 protein)
  6. 1999780Protein Putative methyltransferase TM0872, insert domain [81801] (2 species)
  7. 1999786Species Thermus thermophilus [TaxId:274] [116940] (1 PDB entry)
    Uniprot Q5SJD8
  8. 1999787Domain d1wg8a1: 1wg8 A:109-206 [114605]
    Other proteins in same PDB: d1wg8a2, d1wg8b2
    Structural genomics target
    complexed with sam

Details for d1wg8a1

PDB Entry: 1wg8 (more details), 2 Å

PDB Description: Crystal structure of a predicted S-adenosylmethionine-dependent methyltransferase TT1512 from Thermus thermophilus HB8.
PDB Compounds: (A:) predicted S-adenosylmethionine-dependent methyltransferase

SCOPe Domain Sequences for d1wg8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg8a1 a.60.13.1 (A:109-206) Putative methyltransferase TM0872, insert domain {Thermus thermophilus [TaxId: 274]}
rgfsyqkegpldmrmglegptakevvnrlplealarllrelgeepqayriaraivaarek
apietttqlaeivrkavgfrraghparktfqalriyvn

SCOPe Domain Coordinates for d1wg8a1:

Click to download the PDB-style file with coordinates for d1wg8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wg8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wg8a2