Lineage for d1wg7a1 (1wg7 A:8-144)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412662Protein Dedicator of cytokinesis protein 9, DOCK9 [117248] (1 species)
  7. 2412663Species Human (Homo sapiens) [TaxId:9606] [117249] (1 PDB entry)
    Uniprot Q9BZ29 165-301
  8. 2412664Domain d1wg7a1: 1wg7 A:8-144 [114604]
    Other proteins in same PDB: d1wg7a2, d1wg7a3
    Structural genomics target

Details for d1wg7a1

PDB Entry: 1wg7 (more details)

PDB Description: solution structure of pleckstrin homology domain from human kiaa1058 protein
PDB Compounds: (A:) Dedicator of cytokinesis protein 9

SCOPe Domain Sequences for d1wg7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg7a1 b.55.1.1 (A:8-144) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]}
aaslgsqkggitkhgwlykgnmnsaisvtmrsfkrrffhliqlgdgsynlnfykdekisk
epkgsifldscmgvvqnnkvrrfafelkmqdkssyllaadsevemeewitilnkilqlnf
eaamqekrngdshedde

SCOPe Domain Coordinates for d1wg7a1:

Click to download the PDB-style file with coordinates for d1wg7a1.
(The format of our PDB-style files is described here.)

Timeline for d1wg7a1: