SCOP 1.71: Domain d1wg7a_: 1wg7 A:

Lineage for d1wg7a_ (1wg7 A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.55: PH domain-like [50728] (1 superfamily)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (9 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (30 proteins)
   Pfam 00169

6. Protein Dedicator of cytokinesis protein 9, DOCK9 [117248] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117249] (1 PDB entry)

8. Domain d1wg7a_: 1wg7 A: [114604]
   Structural genomics target

Details for d1wg7a_

PDB Entry: 1wg7

PDB Description: solution structure of pleckstrin homology domain from human kiaa1058 protein

SCOP Domain Sequences for d1wg7a_:

Sequence; same for both SEQRES and ATOM records:

>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens)}
gssgssgaaslgsqkggitkhgwlykgnmnsaisvtmrsfkrrffhliqlgdgsynlnfy
kdekiskepkgsifldscmgvvqnnkvrrfafelkmqdkssyllaadsevemeewitiln
kilqlnfeaamqekrngdsheddesgpssg

Timeline for d1wg7a_:

• d1wg7a_ is new in SCOP 1.71
  
• d1wg7a_ appears in SCOP 1.73
  
• d1wg7a_ appears in the current release, SCOPe 2.08, called d1wg7a1