SCOPe 2.08: Domain d1wg7a1: 1wg7 A:8-144

Lineage for d1wg7a1 (1wg7 A:8-144)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Dedicator of cytokinesis protein 9, DOCK9 [117248] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117249] (1 PDB entry)
   Uniprot Q9BZ29 165-301

8. Domain d1wg7a1: 1wg7 A:8-144 [114604]
   Other proteins in same PDB: d1wg7a2, d1wg7a3
   Structural genomics target

Details for d1wg7a1

PDB Entry: 1wg7

PDB Description: solution structure of pleckstrin homology domain from human kiaa1058 protein

PDB Compounds: (A:) Dedicator of cytokinesis protein 9

SCOPe Domain Sequences for d1wg7a1:

Sequence; same for both SEQRES and ATOM records:

>d1wg7a1 b.55.1.1 (A:8-144) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]}
aaslgsqkggitkhgwlykgnmnsaisvtmrsfkrrffhliqlgdgsynlnfykdekisk
epkgsifldscmgvvqnnkvrrfafelkmqdkssyllaadsevemeewitilnkilqlnf
eaamqekrngdshedde

Timeline for d1wg7a1:

• d1wg7a1 first appeared in SCOP 1.71, called d1wg7a_
  
• d1wg7a1 appears in SCOPe 2.07