Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Dedicator of cytokinesis protein 9, DOCK9 [117248] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117249] (1 PDB entry) Uniprot Q9BZ29 165-301 |
Domain d1wg7a1: 1wg7 A:8-144 [114604] Other proteins in same PDB: d1wg7a2, d1wg7a3 Structural genomics target |
PDB Entry: 1wg7 (more details)
SCOPe Domain Sequences for d1wg7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wg7a1 b.55.1.1 (A:8-144) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} aaslgsqkggitkhgwlykgnmnsaisvtmrsfkrrffhliqlgdgsynlnfykdekisk epkgsifldscmgvvqnnkvrrfafelkmqdkssyllaadsevemeewitilnkilqlnf eaamqekrngdshedde
Timeline for d1wg7a1: