Lineage for d1wg6a1 (1wg6 A:8-121)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048426Protein Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) [117178] (1 species)
  7. 2048427Species Mouse (Mus musculus) [TaxId:10090] [117179] (1 PDB entry)
    Uniprot Q5SV53 478-591
  8. 2048428Domain d1wg6a1: 1wg6 A:8-121 [114603]
    Other proteins in same PDB: d1wg6a2, d1wg6a3
    Structural genomics target

Details for d1wg6a1

PDB Entry: 1wg6 (more details)

PDB Description: Solution structure of PDZ domain in protein XP_110852
PDB Compounds: (A:) HYPOTHETICAL PROTEIN (RIKEN cDNA 2810455B10)

SCOPe Domain Sequences for d1wg6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg6a1 b.36.1.1 (A:8-121) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]}
lkgepdcyalslesseqltleiplndsgsaglgvslkgnksretgtdlgifiksiihgga
afkdgrlrmndqliavngetllgksnheametlrrsmsmegnirgmiqlvilrr

SCOPe Domain Coordinates for d1wg6a1:

Click to download the PDB-style file with coordinates for d1wg6a1.
(The format of our PDB-style files is described here.)

Timeline for d1wg6a1: